PDB entry 2fk0

View 2fk0 on RCSB PDB site
Description: Crystal Structure of a H5N1 influenza virus hemagglutinin.
Class: viral protein
Keywords: glycoprotein, membrane-fusion precursor, viral protein
Deposited on 2006-01-03, released 2006-05-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.269
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0a1
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0b1
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0l_
  • Chain 'M':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0m_
  • Chain 'N':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0n_
  • Chain 'O':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0o_
  • Chain 'P':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0p_
  • Chain 'Q':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAT73274 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.05: d2fk0q_
  • Chain 'R':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Viet Nam/1203/2004(H5N1)) [TaxId:284218]
    Database cross-references and differences (RAF-indexed):
    • GB AAW80717 (0-173)
      • cloning artifact (174)
    Domains in SCOPe 2.05: d2fk0r_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fk0A (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0A (A:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fk0B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fk0C (C:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0C (C:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fk0D (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0D (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fk0E (E:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0E (E:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fk0F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fk0G (G:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0G (G:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fk0H (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0H (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2fk0I (I:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0I (I:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2fk0J (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0J (J:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fk0K (K:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0K (K:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2fk0L (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0L (L:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2fk0M (M:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0M (M:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fk0N (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0N (N:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2fk0O (O:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0O (O:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2fk0P (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0P (P:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2fk0Q (Q:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0Q (Q:)
    gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
    sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
    hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrnsp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2fk0R (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk0R (R:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss