PDB entry 2fjz

View 2fjz on RCSB PDB site
Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Class: metal binding protein
Keywords: Alpha-beta two-layered sandwich, METAL BINDING PROTEIN
Deposited on 2006-01-03, released 2007-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.177
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid beta A4 protein precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: APP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05067 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.05: d2fjza_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fjzA (A:)
  eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl