PDB entry 2fjz

View 2fjz on RCSB PDB site
Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) copper binding domain (residues 133 to 189) in 'small unit cell' form, metal-free
Class: metal binding protein
Keywords: Alpha-beta two-layered sandwich, METAL BINDING PROTEIN
Deposited on 2006-01-03, released 2007-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05067 (2-58)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fjza1, d2fjza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjzA (A:)
    eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl