PDB entry 2fjy

View 2fjy on RCSB PDB site
Description: Crystal Structure of B-form Bombyx mori Pheromone Binding Protein
Class: transport protein
Keywords: alpha helical
Deposited on 2006-01-03, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori
    Gene: PBP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjya1
  • Chain 'B':
    Compound: pheromone-binding protein
    Species: Bombyx mori
    Gene: PBP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjyb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fjyA (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavgeilaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjyA (A:)
    nlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstklnmldpeg
    nlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfkaeihkln
    wapsmdvavgeilaev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjyB (B:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavgeilaev