PDB entry 2fjy

View 2fjy on RCSB PDB site
Description: Crystal Structure of B-form Bombyx mori Pheromone Binding Protein
Class: transport protein
Keywords: alpha helical, TRANSPORT PROTEIN
Deposited on 2006-01-03, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori [TaxId:7091]
    Gene: PBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fjya_
  • Chain 'B':
    Compound: pheromone-binding protein
    Species: Bombyx mori [TaxId:7091]
    Gene: PBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fjyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fjyA (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavgeilaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjyA (A:)
    nlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstklnmldpeg
    nlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfkaeihkln
    wapsmdvavgeilaev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjyB (B:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmdvavgeilaev