PDB entry 2fjx

View 2fjx on RCSB PDB site
Description: RT29 bound to D(CTTGAATGCATTCAAG) in complex with MMLV RT catalytic fragment
Class: transferase/DNA
Keywords: MMLV RT, protein-DNA complex, water-mediated interaction, DNA-drug complex, RT29, TRANSFERASE/DNA COMPLEX
Deposited on 2006-01-03, released 2006-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.234
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Murine leukemia virus [TaxId:11801]
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fjxa_
  • Chain 'B':
    Compound: 5'-d(*cp*tp*tp*gp*ap*ap*tp*g)-3'
  • Chain 'G':
    Compound: 5'-d(p*cp*ap*tp*tp*cp*ap*ap*g)-3'
  • Heterogens: HXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fjxA (A:)
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.