PDB entry 2fjw

View 2fjw on RCSB PDB site
Description: d(CTTGAATGCATTCAAG) in complex with MMLV RT catalytic fragment
Class: transferase/DNA
Keywords: protein-DNA complex, drug-DNA complex, water-mediated interaction, benzimidazole, minor groove
Deposited on 2006-01-03, released 2006-06-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.237
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Moloney murine leukemia virus
    Gene: pol
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fjwa1
  • Chain 'B':
    Compound: 5'-d(*cp*tp*tp*gp*ap*ap*tp*g)-3'
  • Chain 'G':
    Compound: 5'-d(p*cp*ap*tp*tp*cp*ap*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjwA (A:)
    twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
    qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
    qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
    hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
    kqvkylgyllkegqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    No sequence available.