PDB entry 2fjl

View 2fjl on RCSB PDB site
Description: Solution Structure of the Split PH domain in Phospholipase C-gamma1
Class: Hydrolase
Keywords: beta-barrel, Hydrolase
Deposited on 2006-01-03, released 2006-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10686 (67-149)
      • linker (59-66)
    Domains in SCOPe 2.07: d2fjla1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjlA (A:)
    sikngilyledpvnhewyphyfvltsskiyyseetssdqgnedeeepkeasgstelhssl
    evlfqgpnpaileperehldensplgdllrgvldvpacqiairpegknnrlfvfsismps
    vaqwsldvaadsqeelqdwvkkirevaqta