PDB entry 2fjj

View 2fjj on RCSB PDB site
Description: Solution Structure of Drosophila melanogaster SNF RBD1
Class: RNA binding protein
Keywords: SNF RBD1, RNA binding, RNA splicing, solution structure, RNA BINDING PROTEIN
Deposited on 2006-01-02, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-06-03, with a file datestamp of 2008-05-30.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fjja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjjA (A:)
    memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
    sasnalrtmqgfpfydkpmqiaysksdsdivakikgtfkerpkk