PDB entry 2fjf

View 2fjf on RCSB PDB site
Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
Class: immune system
Keywords: Antibody, Fab, Dodecamer
Deposited on 2006-01-02, released 2006-02-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfb1, d2fjfb2
  • Chain 'C':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfd1, d2fjfd2
  • Chain 'E':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjff1, d2fjff2
  • Chain 'G':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfh1, d2fjfh2
  • Chain 'I':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfi1, d2fjfi2
  • Chain 'J':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfk1, d2fjfk2
  • Chain 'L':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfn1, d2fjfn2
  • Chain 'O':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfp1, d2fjfp2
  • Chain 'Q':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfr1, d2fjfr2
  • Chain 'S':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjft1, d2fjft2
  • Chain 'U':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfv1, d2fjfv2
  • Chain 'W':
    Compound: Light Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Heavy Chain of a VEGF binding Antibody
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjfx1, d2fjfx2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fjfB (B:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfB (B:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fjfD (D:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfD (D:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fjfF (F:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfF (F:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fjfH (H:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfH (H:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2fjfI (I:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfI (I:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fjfK (K:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfK (K:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fjfN (N:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfN (N:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2fjfP (P:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfP (P:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2fjfR (R:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfR (R:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2fjfT (T:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfT (T:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2fjfV (V:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfV (V:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fjfX (X:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjfX (X:)
    evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
    adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
    astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc