PDB entry 2fje

View 2fje on RCSB PDB site
Description: adenosine-5-phosphosulfate reductase oxidized state
Class: oxidoreductase
Keywords: APS reductase, sulfur cycle
Deposited on 2006-01-02, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylylsulfate reductase, subunit A
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: adenylylsulfate reductase, subunit B
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjeb1
  • Chain 'C':
    Compound: adenylylsulfate reductase, subunit A
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: adenylylsulfate reductase, subunit B
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fjed1
  • Heterogens: FAD, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fjeB (B:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjeB (B:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fjeD (D:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjeD (D:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka