PDB entry 2fjc

View 2fjc on RCSB PDB site
Description: Crystal structure of antigen TpF1 from Treponema pallidum
Class: metal transport
Keywords: Mini ferritin, iron binding protein, antigen, METAL TRANSPORT
Deposited on 2006-01-02, released 2006-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjca1
  • Chain 'B':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcb_
  • Chain 'C':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcc_
  • Chain 'D':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcd_
  • Chain 'E':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjce_
  • Chain 'F':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcf_
  • Chain 'G':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcg_
  • Chain 'H':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjch_
  • Chain 'I':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjci_
  • Chain 'J':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcj_
  • Chain 'K':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjck_
  • Chain 'L':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcl_
  • Chain 'M':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcm_
  • Chain 'N':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcn_
  • Chain 'O':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjco_
  • Chain 'P':
    Compound: Antigen TpF1
    Species: Treponema pallidum [TaxId:160]
    Gene: tpf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fjcp_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fjcA (A:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcA (A:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fjcB (B:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fjcC (C:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcC (C:)
    daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
    erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
    sgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fjcD (D:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcD (D:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fjcE (E:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcE (E:)
    daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
    erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
    sgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fjcF (F:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcF (F:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fjcG (G:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcG (G:)
    daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
    erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
    sgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fjcH (H:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcH (H:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2fjcI (I:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcI (I:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2fjcJ (J:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcJ (J:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fjcK (K:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcK (K:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2fjcL (L:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcL (L:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2fjcM (M:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcM (M:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fjcN (N:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcN (N:)
    daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
    erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
    sgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2fjcO (O:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcO (O:)
    daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
    erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
    sgdavtdgiitdilrtlgkaiwmlgatlka
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2fjcP (P:)
    sapgvpdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvte
    afdtiaerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqt
    qvlaaesgdavtdgiitdilrtlgkaiwmlgatlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjcP (P:)
    pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
    aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
    esgdavtdgiitdilrtlgkaiwmlgatlka