PDB entry 2fjb

View 2fjb on RCSB PDB site
Description: Adenosine-5'-phosphosulfate reductase im complex with products
Class: oxidoreductase
Keywords: APS reductase, sulfur cycle, oxidoreductase
Deposited on 2006-01-02, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylylsulfate reductase, subunit A
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89579
  • Chain 'B':
    Compound: adenylylsulfate reductase, subunit B
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89580
    Domains in SCOPe 2.08: d2fjbb_
  • Chain 'C':
    Compound: adenylylsulfate reductase, subunit A
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89579 (Start-642)
  • Chain 'D':
    Compound: adenylylsulfate reductase, subunit B
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • GB AAB89580 (Start-149)
    Domains in SCOPe 2.08: d2fjbd_
  • Heterogens: SFD, AMP, NA, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fjbB (B:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjbB (B:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fjbD (D:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjbD (D:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka