PDB entry 2fj6

View 2fj6 on RCSB PDB site
Description: Solution NMR structure of the UPF0346 protein yozE from Bacillus subtilis. Northeast Structural Genomics target SR391.
Class: structural genomics, unknown function
Keywords: SR391, NMR Structure, AutoStructure, Northeast Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2005-12-31, released 2006-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-14, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0346 protein yozE
    Species: Bacillus subtilis
    Gene: yozE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31864 (0-73)
      • his tag (74-81)
    Domains in SCOP 1.73: d2fj6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fj6A (A:)
    mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatf
    deawdqyesevhgrlehhhhhh