PDB entry 2fj6

View 2fj6 on RCSB PDB site
Description: Solution NMR structure of the UPF0346 protein yozE from Bacillus subtilis. Northeast Structural Genomics target SR391.
Class: structural genomics, unknown function
Keywords: SR391, NMR Structure, AutoStructure, Northeast Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-12-31, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical UPF0346 protein yozE
  Species: Bacillus subtilis [TaxId:1423]
  Gene: yozE
  Database cross-references and differences (RAF-indexed):
  • Uniprot O31864 (0-73)
    • expression tag (74-81)
  Domains in SCOPe 2.08: d2fj6a1, d2fj6a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fj6A (A:)
  mksfyhyllkyrhpkpkdsisefanqayedhsfpktstdyheissylelnadylhtmatf
  deawdqyesevhgrlehhhhhh