PDB entry 2fj1

View 2fj1 on RCSB PDB site
Description: Crystal Structure Analysis of Tet Repressor (class D) in Complex with 7-Chlortetracycline-Nickel(II)
Class: transcription regulator
Keywords: TRANSCRIPTION REGULATION, helix-turn-helix, metal coordination
Deposited on 2005-12-30, released 2007-01-09
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.149
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • engineered (0)
    Domains in SCOP 1.73: d2fj1a1, d2fj1a2
  • Heterogens: NI, CL, CTC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fj1A (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv