PDB entry 2fiw

View 2fiw on RCSB PDB site
Description: Crystal Structure of the GCN5-Related N-acetyltransferase: Aminotransferase, Class-II from Rhodopseudomonas palustris
Class: transferase
Keywords: alpha-beta-alpha sandwich, GCN4-related acetyltransferase , Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-12-30, released 2006-02-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GCN5-related N-acetyltransferase:Aminotransferase, class-II
    Species: Rhodopseudomonas palustris CGA009
    Database cross-references and differences (RAF-indexed):
    • GB CAE27440 (3-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • insertion (3)
      • modified residue (4)
      • modified residue (86)
      • modified residue (155)
    Domains in SCOP 1.75: d2fiwa1
  • Heterogens: SO4, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fiwA (A:)
ghmvmstpalrpylpedaavtaaifvasieqltaddyseeqqeawasaaddeakfaarls
gqltliatlqgvpvgfaslkgpdhidmlyvhpdyvgrdvgttlidaleklagargalilt
vdasdnaaeffakrgyvakqrntvsingewlanttmtksladsaapgassgs

    Sequence, based on observed residues (ATOM records): (download) 
    >2fiwA (A:)
ghmvmstpalrpylpedaavtaaifvasieqltaddyseeqqeawasaaddeakfaarls
gqltliatlqgvpvgfaslkgpdhidmlyvhpdyvgrdvgttlidaleklagargalilt
vdasdnaaeffakrgyvakqrntvsingewlanttmtksl