PDB entry 2fiv

View 2fiv on RCSB PDB site
Description: crystal structure of feline immunodeficiency virus protease complexed with a substrate
Deposited on 1997-07-21, released 1997-11-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2fiva_
  • Chain 'B':
    Domains in SCOP 1.57: d2fivb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fivA (A:)
vgttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fivB (B:)
vgttttlekrpeilifvngypikfllntgaditilnrrdfqvknsiengrqnmigvgggk
rgtnyinvhleirdenyktqcifgnvcvlednsliqpllgrdnmikfnirlvm