PDB entry 2fiu

View 2fiu on RCSB PDB site
Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens
Class: Structural Genomics, Unknown function
Keywords: alpha-beta, dimeric alpha-beta barrels, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Unknown function
Deposited on 2005-12-30, released 2006-02-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • GB AAL41319 (2-96)
      • modified residue (2)
      • modified residue (90-91)
      • cloning artifact (97)
    Domains in SCOPe 2.03: d2fiua1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • GB AAL41319 (2-96)
      • modified residue (2)
      • modified residue (90-91)
      • cloning artifact (97)
    Domains in SCOPe 2.03: d2fiub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fiuA (A:)
    ghmakgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvvie
    fpsvqhaidcynspeyqaaakirqevadaemmivegigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiuA (A:)
    makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
    svqhaidcynspeyqaaakirqevadaemmivegig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fiuB (B:)
    ghmakgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvvie
    fpsvqhaidcynspeyqaaakirqevadaemmivegigs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiuB (B:)
    makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
    svqhaidcynspeyqaaakirqevadaemmivegig