PDB entry 2fia

View 2fia on RCSB PDB site
Description: The crystal structure of the acetyltransferase from Enterococcus faecalis
Class: transferase
Keywords: Acetyltransferase, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2005-12-28, released 2006-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyltransferase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: GI:29343911
    Database cross-references and differences (RAF-indexed):
    • GB AAO81671 (0-End)
    Domains in SCOPe 2.08: d2fiaa1
  • Chain 'B':
    Compound: Acetyltransferase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: GI:29343911
    Database cross-references and differences (RAF-indexed):
    • GB AAO81671 (0-End)
    Domains in SCOPe 2.08: d2fiab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fiaA (A:)
    mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheem
    ifsmatfcmeqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtn
    hrmirffeskgftkiheslqmnrldfgsfylyvkelenqsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiaA (A:)
    mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheem
    ifsmatfcmeqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtn
    hrmirffeskgftkiheslqmnrldfgsfylyvkele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fiaB (B:)
    mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheem
    ifsmatfcmeqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtn
    hrmirffeskgftkiheslqmnrldfgsfylyvkelenqsiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fiaB (B:)
    mkirvadekelpmilqfltevkaymdvvgitqwtkdypsqgdiqeditkkrlyllvheem
    ifsmatfcmeqeqdfvwlkrfatspnyiakgygsllfhelekravwegrrkmyaqtnhtn
    hrmirffeskgftkiheslqmnrldfgsfylyvkelenq