PDB entry 2fi9

View 2fi9 on RCSB PDB site
Description: The crystal structure of an outer membrane protein from the Bartonella henselae
Class: membrane protein
Keywords: Structural Genomics,Outer membrane protein, Bartonella henselae, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, MEMBRANE PROTEIN
Deposited on 2005-12-28, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Outer membrane protein
  Species: Bartonella henselae [TaxId:283166]
  Gene: GI:49238164
  Database cross-references and differences (RAF-indexed):
  • GB CAF27373 (Start-127)
  Domains in SCOPe 2.07: d2fi9a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2fi9A (A:)
  mshaiqireahfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedis
  rvleesdqievlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedrav
  aallfave
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fi9A (A:)
  hfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedisrvleesdqie
  vlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedravaallfave