PDB entry 2fi9

View 2fi9 on RCSB PDB site
Description: The crystal structure of an outer membrane protein from the Bartonella henselae
Class: membrane protein
Keywords: Structural Genomics,Outer membrane protein, Bartonella henselae, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, MEMBRANE PROTEIN
Deposited on 2005-12-28, released 2006-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein
    Species: Bartonella henselae [TaxId:283166]
    Gene: GI:49238164
    Database cross-references and differences (RAF-indexed):
    • GB CAF27373 (Start-127)
    Domains in SCOPe 2.06: d2fi9a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fi9A (A:)
    mshaiqireahfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedis
    rvleesdqievlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedrav
    aallfave
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fi9A (A:)
    hfpgrapidaygnggfrfadmshrgsiicipsgiygidmtgpvptqedisrvleesdqie
    vlligtgvellrlpeelrvllwekrissdtmstgaavrtfnvllaedravaallfave