PDB entry 2fi4

View 2fi4 on RCSB PDB site
Description: Crystal structure of a BPTI variant (Cys14->Ser) in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE-INHIBITOR COMPLEX, hydrolase-hydrolase inhibitor COMPLEX
Deposited on 2005-12-27, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (96)
    Domains in SCOPe 2.08: d2fi4e_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered mutation (13)
    Domains in SCOPe 2.08: d2fi4i1
  • Heterogens: NA, CA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fi4E (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaasldsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fi4I (I:)
    rpdfcleppytgpskariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga