PDB entry 2fi3

View 2fi3 on RCSB PDB site
Description: Crystal structure of a BPTI variant (Cys14->Ser, Cys38->Ser) in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE-INHIBITOR COMPLEX, hydrolase-hydrolase inhibitor COMPLEX
Deposited on 2005-12-27, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fi3e_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered (13)
      • engineered (37)
    Domains in SCOPe 2.06: d2fi3i1
  • Heterogens: NA, CA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fi3E (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fi3I (I:)
    rpdfcleppytgpskariiryfynakaglcqtfvyggsrakrnnfksaedcmrtcgga