PDB entry 2fi3
View 2fi3 on RCSB PDB site
Description: Crystal structure of a BPTI variant (Cys14->Ser, Cys38->Ser) in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE-INHIBITOR COMPLEX, hydrolase-hydrolase inhibitor COMPLEX
Deposited on
2005-12-27, released
2006-01-24
The last revision prior to the SCOPe 2.05 freeze date was dated
2010-03-31, with a file datestamp of
2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: cationic trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2fi3e_ - Chain 'I':
Compound: pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00974 (0-57)
- engineered (13)
- engineered (37)
Domains in SCOPe 2.05: d2fi3i1 - Heterogens: NA, CA, SO4, EDO, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2fi3E (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2fi3I (I:)
rpdfcleppytgpskariiryfynakaglcqtfvyggsrakrnnfksaedcmrtcgga