PDB entry 2fi3

View 2fi3 on RCSB PDB site
Description: Crystal structure of a BPTI variant (Cys14->Ser, Cys38->Ser) in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: protease-inhibitor complex
Deposited on 2005-12-27, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.203
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: cationic trypsin
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-215)
  Domains in SCOP 1.73: d2fi3e1
• Chain 'I':
  Compound: pancreatic trypsin inhibitor
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • engineered (13)
    • engineered (37)
• Heterogens: NA, CA, SO4, EDO, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fi3E (E:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
  

  
  
• Chain 'I':
  No sequence available.