PDB entry 2fi2

View 2fi2 on RCSB PDB site
Description: Solution structure of the SCAN homodimer from MZF-1/ZNF42
Class: transcription
Keywords: SCAN domain, Znf-42, MZF-1, homodimer, transcription factor, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2005-12-27, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 42
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF42, MZF1, ZSCAN6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28698 (2-93)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fi2a1, d2fi2a2
  • Chain 'B':
    Compound: Zinc finger protein 42
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF42, MZF1, ZSCAN6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28698 (2-93)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2fi2b2, d2fi2b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fi2A (A:)
    gsdpgpeaarlrfrcfhyeeatgpqealaqlrelcrqwlrpevrskeqmlellvleqflg
    alppeiqarvqgqrpgspeeaaalvdglrrepgg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fi2B (B:)
    gsdpgpeaarlrfrcfhyeeatgpqealaqlrelcrqwlrpevrskeqmlellvleqflg
    alppeiqarvqgqrpgspeeaaalvdglrrepgg