PDB entry 2fi0

View 2fi0 on RCSB PDB site
Description: The crystal structure of the conserved domain protein from Streptococcus pneumoniae TIGR4
Class: structural genomics, unknown function
Keywords: Structural genomics,Streptococcus pneumoniae, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-12-27, released 2006-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved domain protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • GB AAK74717 (Start-80)
    Domains in SCOPe 2.06: d2fi0a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fi0A (A:)
    mevvmdniidvsipvaevvdkhpevleilvelgfkplanplmrntvgrkvslkqgsklag
    tpmdkivrtleangyevigld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fi0A (A:)
    vvmdniidvsipvaevvdkhpevleilvelgfkplanplmrntvgrkvslkqgsklagtp
    mdkivrtleangyevigld