PDB entry 2fhs

View 2fhs on RCSB PDB site
Description: Structure of Acyl Carrier Protein Bound to FabI, the Enoyl Reductase from Escherichia Coli
Class: oxidoreductase/biosynthetic protein
Keywords: protein-protein complex
Deposited on 2005-12-27, released 2006-10-17
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl-carrier-protein] reductase, NADH-dependent
    Species: Escherichia coli W3110
    Database cross-references and differences (RAF-indexed):
    • GB BAA14841
    Domains in SCOP 1.73: d2fhsa1
  • Chain 'B':
    Compound: enoyl-[acyl-carrier-protein] reductase, NADH-dependent
    Species: Escherichia coli W3110
    Database cross-references and differences (RAF-indexed):
    • GB BAA14841
    Domains in SCOP 1.73: d2fhsb1
  • Chain 'C':
    Compound: Acyl carrier protein
    Species: Escherichia coli
    Gene: acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fhsc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhsA (A:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhsA (A:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
    gevvhvdggfsiaamnel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fhsB (B:)
    mgflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdiv
    lqcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdis
    sysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpe
    gvrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagi
    sgevvhvdggfsiaamnelelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhsB (B:)
    gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
    qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
    ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
    vrvnaisagpirtikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvh
    vdggfsiaamnel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fhsC (C:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhsC (C:)
    stieerviigvkqeevtnnfvedlgasldtvelvmaleeefdtttvqaaidyinghq