PDB entry 2fhr

View 2fhr on RCSB PDB site
Description: Trypanosoma Rangeli Sialidase In Complex With 2,3- Difluorosialic Acid (Covalent Intermediate)
Class: hydrolase
Keywords: beta-propeller, covalent enzyme-intermediate complex, beta-sandwich, hydrolase
Deposited on 2005-12-26, released 2006-01-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sialidase
    Species: Trypanosoma rangeli [TaxId:5698]
    Database cross-references and differences (RAF-indexed):
    • GB AAC95493 (14-End)
      • cloning artifact (13)
      • see remark 999 (63)
      • see remark 999 (199)
      • see remark 999 (385)
      • see remark 999 (619)
    Domains in SCOPe 2.05: d2fhra1, d2fhra2
  • Heterogens: SO4, FSI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhrA (A:)
    mggshhhhhhgmaslapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgv
    mvaiadaryetsfdnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnk
    lyilvgsfnktrnswtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpa
    efdgiltkefiggvgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrsk
    fgcsepavlewegkliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdc
    qssfvavtiegkrvmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssv
    lykddklyslheintndvyslvfvrligelqlmksvvrtwkeednhlasictpvvpatpp
    skggcgaavptaglvgflshsangsvwedvyrcvdanvanaervpnglkfngvgggavwp
    varqgqtrryqfanyrftlvatvtidelpkgtspllgaglegpgdakllglsydknrqwr
    plygaapasptgswelhkkyhvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfy
    iggprskgaptdsrvtvtnvvlynrrlnsseirtlflsqdmigtdggagtaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhrA (A:)
    slapgssrvelfkrknstvpfeesngtirervvhsfriptivnvdgvmvaiadaryetsf
    dnsfietavkysvddgatwntqiaiknsrassvsrvmdatvivkgnklyilvgsfnktrn
    swtqhrdgsdwepllvvgevtksaangkttatiswgkpvslkplfpaefdgiltkefigg
    vgaaivasngnlvypvqiadmggrvftkimyseddgntwkfaegrskfgcsepavleweg
    kliinnrvdgnrrlvyessdmgktwvealgtlshvwtnsptsnqqdcqssfvavtiegkr
    vmlfthplnlkgrwmrdrlhlwmtdnqrifdvgqisigdensgyssvlykddklyslhei
    ntndvyslvfvrligelqlmksvvrtwkeednhlasictpvkggcgaavptaglvgflsh
    sangsvwedvyrcvdanvanaervpnglkfngvgggavwpvarqgqtrryqfanyrftlv
    atvtidelpkgtspllgaglegpgdakllglsydknrqwrplygaapasptgswelhkky
    hvvltmadrqgsvyvdgqplagsgntvvrgatlpdishfyiggprskgaptdsrvtvtnv
    vlynrrlnsseirtlflsqdmigtd