PDB entry 2fhq

View 2fhq on RCSB PDB site
Description: Crystal Structure of General Stress Protein from Bacteroides thetaiotaomicron
Class: structural genomics, unknown function
Keywords: alpha-beta structure, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-12-26, released 2006-02-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative general stress protein
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • GB AAO76536
      • modified residue (8)
      • modified residue (38)
      • modified residue (51)
      • modified residue (83)
    Domains in SCOPe 2.05: d2fhqa1
  • Chain 'B':
    Compound: putative general stress protein
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • GB AAO76536
      • modified residue (8)
      • modified residue (38)
      • modified residue (51)
      • modified residue (83)
    Domains in SCOPe 2.05: d2fhqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhqA (A:)
    snamstktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslk
    tidflsnpkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvll
    kftanhatywiegtfihkkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhqA (A:)
    tktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfl
    snpkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftan
    hatywiegtfihkkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fhqB (B:)
    snamstktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslk
    tidflsnpkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvll
    kftanhatywiegtfihkkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhqB (B:)
    ktmkekavellqkcevvtlasvnkegyprpvpmskiaaegistiwmstgadslktidfls
    npkaglcfqekgdsvalmgevevvtdeklkqelwqdwfiehfpggptdpgyvllkftanh
    atywiegtfihkkl