PDB entry 2fhn

View 2fhn on RCSB PDB site
Description: Avidin related protein AVR4 (C122S, K109I mutant) in complex with BNA
Class: sugar binding protein
Keywords: avidin, streptavidin, AVR4, high affinity, hydrolytic activity, SUGAR BINDING PROTEIN
Deposited on 2005-12-26, released 2006-03-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.152
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • engineered (108)
    Domains in SCOPe 2.01: d2fhnx_
  • Chain 'Y':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734 (Start-120)
      • engineered (108)
    Domains in SCOPe 2.01: d2fhny_
  • Heterogens: BNI, FMT, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fhnX (X:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwiatrvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhnX (X:)
    csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
    ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwiatrvgynnftrl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2fhnY (Y:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwiatrvgynnftr
    lstvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhnY (Y:)
    csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
    ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwiatrvgynnftrl