PDB entry 2fhl

View 2fhl on RCSB PDB site
Description: avidin related protein (AVR4)-BNA complex
Class: sugar binding protein
Keywords: AVIDIN, AVR4, STREPTAVIDIN, HIGH-AFFINITY, Hydrolytic activity, SUGAR BINDING PROTEIN
Deposited on 2005-12-26, released 2006-03-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.167
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734
      • cloning artifact (121)
    Domains in SCOPe 2.01: d2fhla_
  • Chain 'B':
    Compound: Avidin-related protein 4/5
    Species: Gallus gallus [TaxId:9031]
    Gene: AVR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56734 (Start-120)
      • cloning artifact (121)
    Domains in SCOPe 2.01: d2fhlb_
  • Heterogens: BNI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhlA (A:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftr
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhlA (A:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fhlB (B:)
    arkcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftr
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhlB (B:)
    kcsltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptf
    gftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwkatrvgynnftrls