PDB entry 2fhf

View 2fhf on RCSB PDB site
Description: Crystal Structure Analysis of Klebsiella pneumoniae pullulanase complexed with maltotetraose
Class: hydrolase
Keywords: multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, HYDROLASE
Deposited on 2005-12-23, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pullulanase
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed):
    • GB AAA25124 (Start-1082)
      • engineered (679)
      • engineered (881)
    Domains in SCOPe 2.07: d2fhfa1, d2fhfa2, d2fhfa3, d2fhfa4, d2fhfa5
  • Heterogens: GLC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhfA (A:)
    cdnssssstsgspgspgnpgnpgtpgtpdpqdvvvrlpdvavpgeavqasarqavihlvd
    iagitsstpadyatknlylwnnetcdalsapvadwndvsttptgsdkygpywvipltkes
    gcinvivrdgtnklidsdlrvsfsdftdrtvsviagnsavydsradafraafgvaladah
    wvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvkltpttvnqqvsmrfphla
    sypafklpddvnvdellqgetvaiaaesdgilssatqvqtagvlddtyaaaaealsygaq
    ltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswqggsdlkgafyrya
    mtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalkpegwdgltmphaqktkad
    lakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvqhlkqlsasgvthiellpvf
    dlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsgstveevltqlkqndskdnp
    qvqalntlvaqtdsynwgydpfhytvpegsyatdpegtarikefrtmiqaikqdlgmnvi
    mdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesatccsdsapehrmfakliad
    slavwttdykidgfrfdlmlyhpkaqilsawerikalnpdiyffgegwdsnqsdrfeias
    qinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsgagvlpnelttlsddqarhl
    adltrlgmagnladfvlidkdgavkrgseidyngapggyaadptevvnyvskhdnqtlwd
    misykaaqeadldtrvrmqavslatvmlgqgiafdqqgsellrsksftrdsydsgdwfnr
    vdyslqdnnynvgmprssddgsnydiiarvkdavatpgetelkqmtafyqeltalrkssp
    lftlgdgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesr
    tlqdfagtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpv
    ssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhfA (A:)
    dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
    vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
    sviagnsavydsradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaad
    sngefsdkyvkltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgi
    lssatqvqtagvlddtyaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkvia
    shpmtrdsasgawswqggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseys
    qvvdlndsalkpegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkyla
    ltaqesnmvqhlkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavks
    sefagycdsgstveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsy
    atdpegtarikefrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrl
    nettgsvesatccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsaw
    erikalnpdiyffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgda
    lrqnqgvgsgagvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseid
    yngapggyaadptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqg
    iafdqqgsellrsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvk
    davatpgetelkqmtafyqeltalrkssplftlgdgatvmkrvdfrntgadqqtgllvmt
    iddgmqagasldsrvdgivvainaapesrtlqdfagtslqlsaiqqaagdrslasgvqva
    adgsvtlpawsvavlelpqgesqgaglpvssk