PDB entry 2fhe

View 2fhe on RCSB PDB site
Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione
Class: transferase/substrate
Keywords: transferase-substrate complex
Deposited on 1998-10-21, released 1998-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Fasciola hepatica [TaxId:6192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56598 (0-215)
      • conflict (22)
      • conflict (82)
      • conflict (84)
      • conflict (104)
      • conflict (110)
    Domains in SCOPe 2.07: d2fhea1, d2fhea2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Fasciola hepatica [TaxId:6192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56598 (0-215)
      • conflict (22)
      • conflict (82)
      • conflict (84)
      • conflict (104)
      • conflict (110)
    Domains in SCOPe 2.07: d2fheb1, d2fheb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fheA (A:)
    paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
    kckltqslailryiadkhgmigttseerarvsmiegaavdlrqgisrisyqpkfeqlkeg
    ylkdlpttmkmwsdflgknpylrgtsvshvdfmvyealdairylephcldhfpnlqqfms
    riealpsikaymesnrfikwplngwhaqfgggdapp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fheB (B:)
    paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
    kckltqslailryiadkhgmigttseerarvsmiegaavdlrqgisrisyqpkfeqlkeg
    ylkdlpttmkmwsdflgknpylrgtsvshvdfmvyealdairylephcldhfpnlqqfms
    riealpsikaymesnrfikwplngwhaqfgggdapp