PDB entry 2fh5

View 2fh5 on RCSB PDB site
Description: The Structure of the Mammalian SRP Receptor
Class: transport protein
Keywords: Endomembrane targeting, GTPase, GAP, longin domain, SEDL, signal recognition particle receptor, X-ray structure, TRANSPORT PROTEIN
Deposited on 2005-12-23, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle receptor alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: SRPR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08240 (11-End)
      • cloning artifact (9-10)
    Domains in SCOPe 2.08: d2fh5a1
  • Chain 'B':
    Compound: Signal recognition particle receptor beta subunit
    Species: Mus musculus [TaxId:10090]
    Gene: Srprb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fh5b1
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fh5A (A:)
    mshhhhhhsmvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqerggnnsfthea
    ltlkykldnqfelvfvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtf
    dfqndflrllreaeesskirapttmkkfedsekakkpvrsmietrgekpkekaknskkkg
    akkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh5A (A:)
    hsmvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqethealtlkykldnqfelv
    fvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrllreae
    essk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fh5B (B:)
    markssqravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlid
    lpgheslrfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslli
    acnkqdiamaksakliqqqlekelntlrvtrsaapstldssstapaqlgkkgkefefsql
    plkveflecsakggrgdtgsadiqdlekwlakia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh5B (B:)
    ravlfvglcdsgktllfvrlltgqyrdtqtsitdssaiykvnnnrgnsltlidlpghesl
    rfqlldrfkssaravvfvvdsaafqrevkdvaeflyqvlidsmalknspslliacnkqdi
    amaksakliqqqlekelntlrvtrspaqlgkkgkefefsqlplkveflecsaksadiqdl
    ekwlakia