PDB entry 2fh3

View 2fh3 on RCSB PDB site
Description: C-terminal half of gelsolin soaked in low calcium at pH 8
Class: contractile protein
Keywords: gelsolin, calcium, CONTRACTILE PROTEIN
Deposited on 2005-12-23, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fh3A (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh3A (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmhpprlfacsnkigrfv
    ieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdtpitvv
    kqgfeppsfvgwflgwdddyw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fh3B (B:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh3B (B:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrqgqiiynwqgaqstqdeva
    asailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqtapastr
    lfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrv
    lraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieev
    pgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpi
    tvvkqgfeppsfvgwflgwdddyw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fh3C (C:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh3C (C:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynygqiiynwqgaqstqdevaas
    ailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqtapastrlf
    qvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrvlr
    aqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieevpg
    elmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpitv
    vkqgfeppsfvgwflgwdddyw