PDB entry 2fgw

View 2fgw on RCSB PDB site
Description: x-ray structures of fragments from binding and nonbinding versions of a humanized anti-cd18 antibody: structural indications of the key role of vh residues 59 to 65
Class: immune system
Keywords: immunoglobulin, immune system
Deposited on 1994-01-16, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: h52 fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2FGW (0-End)
    Domains in SCOPe 2.07: d2fgwh1, d2fgwh2
  • Chain 'L':
    Compound: h52 fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA65061 (3-213)
      • conflict (13)
      • conflict (27)
      • conflict (29-30)
      • conflict (49-50)
      • conflict (52)
      • conflict (54)
      • conflict (70)
      • conflict (90-93)
      • conflict (95)
      • conflict (102-103)
    Domains in SCOPe 2.07: d2fgwl1, d2fgwl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fgwH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsh
    nqrfmdrftisvdkststaymqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgwH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsh
    nqrfmdrftisvdkststaymqmnslraedtavyycarwrryfdvwgqgtlvtvssastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fgwL (L:)
    diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlhsgvps
    rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec