PDB entry 2fgo

View 2fgo on RCSB PDB site
Description: Structure of the 2[4FE-4S] ferredoxin from Pseudomonas aeruginosa
Class: electron transport
Keywords: Ferredoxin, Pseudomonas aeruginosa, Allochromatium vinosum, [4Fe-4S] cluster, reduction potential, Iron binding protein, ELECTRON TRANSPORT
Deposited on 2005-12-22, released 2006-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.176
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fgoa_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fgoA (A:)
    slkitddcincdvcepecpngaisqgeeiyvidpnlctecvghydepqcqqvcpvdcipl
    ddanveskdqlmekyrkitgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgoA (A:)
    slkitddcincdvcepecpngaisqgeeiyvidpnlctecvghydepqcqqvcpvdcipl
    ddanveskdqlmekyrkitgk