PDB entry 2fge

View 2fge on RCSB PDB site
Description: Crystal structure of presequence protease PreP from Arabidopsis thaliana
Class: hydrolase, plant protein
Keywords: peptidasome; protease-peptide complex, hydrolase, plant protein
Deposited on 2005-12-21, released 2006-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc metalloprotease (insulinase family)
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LJL3
      • modified residue (49)
      • engineered (79)
      • modified residue (177)
      • modified residue (257)
      • modified residue (298)
      • modified residue (325)
      • modified residue (380)
      • modified residue (400)
      • modified residue (422)
      • modified residue (433)
      • modified residue (480)
      • modified residue (505)
      • modified residue (603)
      • modified residue (650)
      • modified residue (661)
      • modified residue (687)
      • modified residue (703)
      • modified residue (706)
      • modified residue (713)
      • modified residue (717)
      • modified residue (761)
    Domains in SCOPe 2.06: d2fgea1, d2fgea2, d2fgea3, d2fgea4
  • Chain 'B':
    Compound: zinc metalloprotease (insulinase family)
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LJL3
      • modified residue (49)
      • engineered (79)
      • modified residue (177)
      • modified residue (257)
      • modified residue (298)
      • modified residue (325)
      • modified residue (380)
      • modified residue (400)
      • modified residue (422)
      • modified residue (433)
      • modified residue (480)
      • modified residue (505)
      • modified residue (603)
      • modified residue (650)
      • modified residue (661)
      • modified residue (687)
      • modified residue (703)
      • modified residue (706)
      • modified residue (713)
      • modified residue (717)
      • modified residue (761)
    Domains in SCOPe 2.06: d2fgeb1, d2fgeb2, d2fgeb3, d2fgeb4
  • Chain 'D':
    Compound: nonspecific peptide AALTRA
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2FGE (0-5)
  • Chain 'E':
    Compound: nonspecific peptide AALTRA
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2FGE (0-5)
  • Heterogens: ZN, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fgeA (A:)
    vatqpaplypdvgqdeaeklgfekvseefiseckskailfkhkktgcevmsvsnedenkv
    fgvvfrtppkdstgiphilqhsvlcgsrkypvkepfvellkgslhtflnaftypdrtcyp
    vastntkdfynlvdvyldavffpkcvddahtfqqegwhyelndpsedisykgvvfnemkg
    vysqpdnilgriaqqalspentygvdsggdpkdipnltfeefkefhrqyyhpsnariwfy
    gdddpvhrlrvlseyldmfeaspspnsskikfqklfsepvrlvekypagrdgdlkkkhml
    cvnwllsekpldlqtqlalgfldhlmlgtpasplrkillesglgealvssglsdellqpq
    fgiglkgvseenvqkveelimdtlkklaeegfdndaveasmntiefslrenntgsfprgl
    slmlqsiskwiydmdpfeplkyteplkalktriaeegskavfsplieklilnnshrvtie
    mqpdpekatqeeveeknilekvkaamteedlaelarateelklkqetpdppealrcvpsl
    nlgdipkeptyvptevgdingvkvlrhdlftndiiytevvfdigslkhellplvplfcqs
    llemgtkdltfvqlnqligrktggisvypltssvrgkdepcskiivrgksmagraddlfn
    lmncllqevqftdqqrfkqfvsqsrarmenrlrgsghgiaaarmdamlniagwmseqmgg
    lsyleflhtlekkvdedwegisssleeirrsllarngcivnmtadgksltnveksvakfl
    dllpenpsgglvtwdgrlplrneaiviptqvnyvgkagniystgyeldgsayviskhisn
    twlwdrvrvsggayggfcdfdshsgvfsylsyrdpnllktldiydgtgdflrgldvdqet
    ltkaiigtigdvdsyqlpdakgyssllrhllgvtdeerqrkreeilttslkdfkdfaqai
    dvvrdkgvavavasaedidaannersnffevkkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgeA (A:)
    deaeklgfekvseefiseckskailfkhkktgcevmsvsnedenkvfgvvfrtppkdstg
    iphilqhsvlcgsrkypvkepfvellkgslhtflnaftypdrtcypvastntkdfynlvd
    vyldavffpkcvddahtfqqegwhyelndpsedisykgvvfnemkgvysqpdnilgriaq
    qalspentygvdsggdpkdipnltfeefkefhrqyyhpsnariwfygdddpvhrlrvlse
    yldmfeaspspnsskikfqklfsepvrlvekypagrdgdlkkkhmlcvnwllsekpldlq
    tqlalgfldhlmlgtpasplrkillesglgealvssglsdellqpqfgiglkgvseenvq
    kveelimdtlkklaeegfdndaveasmntiefslrenntgsfprglslmlqsiskwiydm
    dpfeplkyteplkalktriaeegskavfsplieklilnnshrvtiemqpdpekatqeeve
    eknilekvkaamteedlaelarateelklkqetpdppealrcvpslnlgdipkeptyvpt
    evgdingvkvlrhdlftndiiytevvfdigslkhellplvplfcqsllemgtkdltfvql
    nqligrktggisvypltssvrgkdepcskiivrgksmagraddlfnlmncllqevqftdq
    qrfkqfvsqsrarmenrlrgsghgiaaarmdamlniagwmseqmgglsyleflhtlekkv
    dedwegisssleeirrsllarngcivnmtadgksltnveksvakfldllpenpsgglvtw
    dgrlplrneaiviptqvnyvgkagniystgyeldgsayviskhisntwlwdrvrvsggay
    ggfcdfdshsgvfsylsyrdpnllktldiydgtgdflrgldvdqetltkaiigtigdvds
    yqlpdakgyssllrhllgvtdeerqrkreeilttslkdfkdfaqaidvvrdkgvavavas
    aedidaannersnffevkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fgeB (B:)
    vatqpaplypdvgqdeaeklgfekvseefiseckskailfkhkktgcevmsvsnedenkv
    fgvvfrtppkdstgiphilqhsvlcgsrkypvkepfvellkgslhtflnaftypdrtcyp
    vastntkdfynlvdvyldavffpkcvddahtfqqegwhyelndpsedisykgvvfnemkg
    vysqpdnilgriaqqalspentygvdsggdpkdipnltfeefkefhrqyyhpsnariwfy
    gdddpvhrlrvlseyldmfeaspspnsskikfqklfsepvrlvekypagrdgdlkkkhml
    cvnwllsekpldlqtqlalgfldhlmlgtpasplrkillesglgealvssglsdellqpq
    fgiglkgvseenvqkveelimdtlkklaeegfdndaveasmntiefslrenntgsfprgl
    slmlqsiskwiydmdpfeplkyteplkalktriaeegskavfsplieklilnnshrvtie
    mqpdpekatqeeveeknilekvkaamteedlaelarateelklkqetpdppealrcvpsl
    nlgdipkeptyvptevgdingvkvlrhdlftndiiytevvfdigslkhellplvplfcqs
    llemgtkdltfvqlnqligrktggisvypltssvrgkdepcskiivrgksmagraddlfn
    lmncllqevqftdqqrfkqfvsqsrarmenrlrgsghgiaaarmdamlniagwmseqmgg
    lsyleflhtlekkvdedwegisssleeirrsllarngcivnmtadgksltnveksvakfl
    dllpenpsgglvtwdgrlplrneaiviptqvnyvgkagniystgyeldgsayviskhisn
    twlwdrvrvsggayggfcdfdshsgvfsylsyrdpnllktldiydgtgdflrgldvdqet
    ltkaiigtigdvdsyqlpdakgyssllrhllgvtdeerqrkreeilttslkdfkdfaqai
    dvvrdkgvavavasaedidaannersnffevkkal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgeB (B:)
    deaeklgfekvseefiseckskailfkhkktgcevmsvsnedenkvfgvvfrtppkdstg
    iphilqhsvlcgsrkypvkepfvellkgslhtflnaftypdrtcypvastntkdfynlvd
    vyldavffpkcvddahtfqqegwhyelndpsedisykgvvfnemkgvysqpdnilgriaq
    qalspentygvdsggdpkdipnltfeefkefhrqyyhpsnariwfygdddpvhrlrvlse
    yldmfeaspspnsskikfqklfsepvrlvekypagrdgdlkkkhmlcvnwllsekpldlq
    tqlalgfldhlmlgtpasplrkillesglgealvssglsdellqpqfgiglkgvseenvq
    kveelimdtlkklaeegfdndaveasmntiefslrenntgsfprglslmlqsiskwiydm
    dpfeplkyteplkalktriaeegskavfsplieklilnnshrvtiemqpdpekatqeeve
    eknilekvkaamteedlaelarateelklkqetpdppealrcvpslnlgdipkeptyvpt
    evgdingvkvlrhdlftndiiytevvfdigslkhellplvplfcqsllemgtkdltfvql
    nqligrktggisvypltssvrgkdepcskiivrgksmagraddlfnlmncllqevqftdq
    qrfkqfvsqsrarmenrlrgsghgiaaarmdamlniagwmseqmgglsyleflhtlekkv
    dedwegisssleeirrsllarngcivnmtadgksltnveksvakfldllpenpsgglvtw
    dgrlplrneaiviptqvnyvgkagniystgyeldgsayviskhisntwlwdrvrvsggay
    ggfcdfdshsgvfsylsyrdpnllktldiydgtgdflrgldvdqetltkaiigtigdvds
    yqlpdakgyssllrhllgvtdeerqrkreeilttslkdfkdfaqaidvvrdkgvavavas
    aedidaannersnffevkk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.