PDB entry 2fgd

View 2fgd on RCSB PDB site
Description: Crystal structure of putative acetolactate synthase-small subunit from Nitrosomonas europea
Class: lyase
Keywords: ACETOLACTATE SYNTHASE, REGULATORY SUBUNIT, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-12-21, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2007-04-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea ATCC 19718
    Database cross-references and differences (RAF-indexed):
    • GB CAD85235 (2-164)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (10)
      • modified residue (47)
      • modified residue (88)
      • modified residue (102)
    Domains in SCOPe 2.08: d2fgda1, d2fgda2, d2fgda3
  • Chain 'B':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea ATCC 19718
    Database cross-references and differences (RAF-indexed):
    • GB CAD85235 (Start-164)
      • modified residue (10)
      • modified residue (47)
      • modified residue (88)
      • modified residue (102)
    Domains in SCOPe 2.08: d2fgdb1, d2fgdb2
  • Chain 'C':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea ATCC 19718
    Database cross-references and differences (RAF-indexed):
    • GB CAD85235 (Start-164)
      • modified residue (10)
      • modified residue (47)
      • modified residue (88)
      • modified residue (102)
    Domains in SCOPe 2.08: d2fgdc1, d2fgdc2
  • Chain 'D':
    Compound: Probable acetolactate synthase isozyme III (Small subunit)
    Species: Nitrosomonas europaea ATCC 19718
    Database cross-references and differences (RAF-indexed):
    • GB CAD85235 (Start-164)
      • modified residue (10)
      • modified residue (47)
      • modified residue (88)
      • modified residue (102)
    Domains in SCOPe 2.08: d2fgdd1, d2fgdd2
  • Heterogens: CA, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fgdA (A:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgdA (A:)
    hmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveq
    itkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnel
    ytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fgdB (B:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgdB (B:)
    rhiisllmenegalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveqitk
    qlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnelyti
    eltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fgdC (C:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgdC (C:)
    rhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeiveqit
    kqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnelyt
    ieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fgdD (D:)
    ghmrhiisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtngpdeive
    qitkqlnklievvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtne
    lytieltgtrskldgflqavdcnlileiartgvsglsrgervlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgdD (D:)
    iisllmeneagalsrvaglfsargynieslsvaptedptlsrmtlvtndeiveqitkqln
    klvvklidlssegyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgt
    rskldgflqavdcnlileiartgvsglsrgervlkl