PDB entry 2fg9

View 2fg9 on RCSB PDB site
Description: Crystal structure of (np_811990.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.20 A resolution
Class: structural genomics, unknown function
Keywords: np_811990.1, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-12-21, released 2006-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5-nitroimidazole antibiotic resistance protein
  Species: Bacteroides thetaiotaomicron VPI-5482
  Gene: np_811990.1
  Database cross-references and differences (RAF-indexed):
  • GB AAO78184 (19-End)
    • leader sequence (6-18)
    • modified residue (19)
    • modified residue (56)
    • modified residue (78)
    • modified residue (108)
    • modified residue (114)
    • modified residue (125)
    • modified residue (136)
    • modified residue (164)
  Domains in SCOP 1.73: d2fg9a1
• Heterogens: NI, FAD, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2fg9A (A:)
  mgsdkihhhhhhenlyfqgmktiviedkqriesiilqadacfvgitdlegnpyvvpmnfg
  yendtlylhsgpeggkiemlqrnnnvcitfslghklvyqhkqvacsysmrsesamcrgkv
  efiedmeekrhaldiimrhytkdqfsysdpavrnvkvwkvpvdqmtgkvfglradekp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fg9A (A:)
  hhhhhhenlyfqgmktiviedkqriesiilqadacfvgitdlegnpyvvpmnfgyendtl
  ylhsgpeggkiemlqrnnnvcitfslghklvyqhcsysmrsesamcrgkvefiedmeekr
  haldiimrhytkdqfsysdpavrnvkvwkvpvdqmtgkvfglrade