PDB entry 2fg9

View 2fg9 on RCSB PDB site
Description: crystal structure of a putative 5-nitroimidazole antibiotic resistance protein (bt_3078) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
Class: oxidoreductase
Keywords: putative 5-nitroimidazole antibiotic resistance protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, oxidoreductase
Deposited on 2005-12-21, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-nitroimidazole antibiotic resistance protein
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: np_811990.1
    Database cross-references and differences (RAF-indexed):
    • GB AAO78184 (19-End)
      • leader sequence (6-18)
      • modified residue (19)
      • modified residue (56)
      • modified residue (78)
      • modified residue (108)
      • modified residue (114)
      • modified residue (125)
      • modified residue (136)
      • modified residue (164)
    Domains in SCOPe 2.08: d2fg9a1, d2fg9a2
  • Heterogens: NI, FAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fg9A (A:)
    mgsdkihhhhhhenlyfqgmktiviedkqriesiilqadacfvgitdlegnpyvvpmnfg
    yendtlylhsgpeggkiemlqrnnnvcitfslghklvyqhkqvacsysmrsesamcrgkv
    efiedmeekrhaldiimrhytkdqfsysdpavrnvkvwkvpvdqmtgkvfglradekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg9A (A:)
    hhhhhhenlyfqgmktiviedkqriesiilqadacfvgitdlegnpyvvpmnfgyendtl
    ylhsgpeggkiemlqrnnnvcitfslghklvyqhcsysmrsesamcrgkvefiedmeekr
    haldiimrhytkdqfsysdpavrnvkvwkvpvdqmtgkvfglrade