PDB entry 2fg8

View 2fg8 on RCSB PDB site
Description: Structure of Human Ferritin L Chain
Class: metal binding protein
Keywords: Ferritin Light Chain Perdeuterated, METAL BINDING PROTEIN
Deposited on 2005-12-21, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8a_
  • Chain 'B':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8b_
  • Chain 'C':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8c_
  • Chain 'D':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8d_
  • Chain 'E':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8e_
  • Chain 'F':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8f_
  • Chain 'G':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8g_
  • Chain 'H':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fg8h_
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8A (A:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8B (B:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8C (C:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8D (D:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8E (E:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8F (F:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8G (G:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fg8H (H:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd