PDB entry 2fg7

View 2fg7 on RCSB PDB site
Description: N-succinyl-L-ornithine transcarbamylase from B. fragilis complexed with carbamoyl phosphate and N-succinyl-L-norvaline
Class: transferase
Keywords: alpha/beta, TRANSFERASE
Deposited on 2005-12-21, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: putative ornithine carbamoyltransferase
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: argF'
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LI27 (20-337)
      • expression tag (18-19)
      • engineered (261)
    Domains in SCOPe 2.08: d2fg7c1, d2fg7c2, d2fg7c3
  • Chain 'D':
    Compound: putative ornithine carbamoyltransferase
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: argF'
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LI27 (20-337)
      • expression tag (18-19)
      • engineered (261)
    Domains in SCOPe 2.08: d2fg7d1, d2fg7d2, d2fg7d3
  • Chain 'E':
    Compound: putative ornithine carbamoyltransferase
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: argF'
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LI27 (20-337)
      • expression tag (18-19)
      • engineered (261)
    Domains in SCOPe 2.08: d2fg7e1, d2fg7e2, d2fg7e3
  • Chain 'X':
    Compound: putative ornithine carbamoyltransferase
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: argF'
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LI27 (20-337)
      • expression tag (17-19)
      • engineered (261)
    Domains in SCOPe 2.08: d2fg7x1, d2fg7x2, d2fg7x3
  • Chain 'Y':
    Compound: putative ornithine carbamoyltransferase
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: argF'
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LI27 (20-337)
      • expression tag (17-19)
      • engineered (261)
    Domains in SCOPe 2.08: d2fg7y1, d2fg7y2, d2fg7y3
  • Chain 'Z':
    Compound: putative ornithine carbamoyltransferase
    Species: BACTEROIDES FRAGILIS [TaxId:272559]
    Gene: argF'
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LI27 (20-337)
      • expression tag (18-19)
      • engineered (261)
    Domains in SCOPe 2.08: d2fg7z1, d2fg7z2, d2fg7z3
  • Heterogens: SO4, SN0, CP, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fg7C (C:)
    mgsshhhhhhssglvprgshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktll
    miffnsslrtrlstqkaalnlgmnvivldinqgawkletergvimdgdkpehlleaipvm
    gcycdiigvrsfarfenreydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitiee
    ykktarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarve
    ydqmkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrn
    mivtddviespqsivipeaanreisatvvlkrllenlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg7C (C:)
    shmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaa
    lnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenr
    eydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykktarpkvvmtwaphpr
    plpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydqmkafegadfiyaknw
    aaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmivtddviespqsivipe
    aanreisatvvlkrllenlp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fg7D (D:)
    mgsshhhhhhssglvprgshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktll
    miffnsslrtrlstqkaalnlgmnvivldinqgawkletergvimdgdkpehlleaipvm
    gcycdiigvrsfarfenreydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitiee
    ykktarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarve
    ydqmkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrn
    mivtddviespqsivipeaanreisatvvlkrllenlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg7D (D:)
    shmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaa
    lnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenr
    eydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykktarpkvvmtwaphpr
    plpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydqmkafegadfiyaknw
    aaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmivtddviespqsivipe
    aanreisatvvlkrllenlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fg7E (E:)
    mgsshhhhhhssglvprgshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktll
    miffnsslrtrlstqkaalnlgmnvivldinqgawkletergvimdgdkpehlleaipvm
    gcycdiigvrsfarfenreydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitiee
    ykktarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarve
    ydqmkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrn
    mivtddviespqsivipeaanreisatvvlkrllenlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg7E (E:)
    shmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaa
    lnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenr
    eydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykktarpkvvmtwaphpr
    plpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydqmkafegadfiyaknw
    aaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmivtddviespqsivipe
    aanreisatvvlkrllenlp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fg7X (X:)
    mgsshhhhhhssglvprgshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktll
    miffnsslrtrlstqkaalnlgmnvivldinqgawkletergvimdgdkpehlleaipvm
    gcycdiigvrsfarfenreydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitiee
    ykktarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarve
    ydqmkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrn
    mivtddviespqsivipeaanreisatvvlkrllenlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg7X (X:)
    gshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqka
    alnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfen
    reydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykktarpkvvmtwaphp
    rplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydqmkafegadfiyakn
    waaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmivtddviespqsivip
    eaanreisatvvlkrllenlp
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2fg7Y (Y:)
    mgsshhhhhhssglvprgshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktll
    miffnsslrtrlstqkaalnlgmnvivldinqgawkletergvimdgdkpehlleaipvm
    gcycdiigvrsfarfenreydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitiee
    ykktarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarve
    ydqmkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrn
    mivtddviespqsivipeaanreisatvvlkrllenlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg7Y (Y:)
    gshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqka
    alnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfen
    reydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykktarpkvvmtwaphp
    rplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydqmkafegadfiyakn
    waaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmivtddviespqsivip
    eaanreisatvvlkrllenlp
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2fg7Z (Z:)
    mgsshhhhhhssglvprgshmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktll
    miffnsslrtrlstqkaalnlgmnvivldinqgawkletergvimdgdkpehlleaipvm
    gcycdiigvrsfarfenreydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitiee
    ykktarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarve
    ydqmkafegadfiyaknwaaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrn
    mivtddviespqsivipeaanreisatvvlkrllenlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg7Z (Z:)
    shmkkftcvqdigdlksalaesfeikkdrfkyvelgrnktllmiffnsslrtrlstqkaa
    lnlgmnvivldinqgawkletergvimdgdkpehlleaipvmgcycdiigvrsfarfenr
    eydyneviinqfiqhsgrpvfsmeaatrhplqsfadlitieeykktarpkvvmtwaphpr
    plpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydqmkafegadfiyaknw
    aaylgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmivtddviespqsivipe
    aanreisatvvlkrllenlp