PDB entry 2fg4

View 2fg4 on RCSB PDB site
Description: Structure of Human Ferritin L Chain
Class: metal binding protein
Keywords: Human Light Chain Ferritin, METAL BINDING PROTEIN
Deposited on 2005-12-21, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fg4a_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fg4A (A:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg4A (A:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltl