PDB entry 2fg0

View 2fg0 on RCSB PDB site
Description: Crystal structure of (53686717) from Nostoc punctiforme PCC 73102 at 1.79 A resolution
Class: structural genomics, unknown function
Keywords: 53686717, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-12-20, released 2006-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.154
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COG0791: Cell wall-associated hydrolases (invasion-associated proteins)
    Species: Nostoc punctiforme PCC 73102
    Gene: 53686717
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00105875 (Start-245)
      • modified residue (119)
      • modified residue (141)
    Domains in SCOP 1.73: d2fg0a1, d2fg0a2
  • Chain 'B':
    Compound: COG0791: Cell wall-associated hydrolases (invasion-associated proteins)
    Species: Nostoc punctiforme PCC 73102
    Gene: 53686717
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00105875 (Start-245)
      • modified residue (119)
      • modified residue (141)
    Domains in SCOP 1.73: d2fg0b1, d2fg0b2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fg0A (A:)
    mgsdkihhhhhhmvrlseaevqnpklgeyqcladlnlfdspectrlatqsasgrhlwvts
    nhqnlavevylceddypgwlslsdfdslqpatvpyqaatfseseikkllaeviaftqkam
    qqsnyylwggtvgpnydcsglmqaafasvgiwlprdayqqegftqpitiaelvagdlvff
    gtsqkathvglyladgyyihssgkdqgrdgigidilseqgdavslsyyqqlrgagrvfks
    yepqrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg0A (A:)
    klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd
    fdslqpatvpyqaatfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqa
    afasvgiwlprdayqqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgk
    dqgrdgigidilseqgdavslsyyqqlrgagrvfksyepqrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fg0B (B:)
    mgsdkihhhhhhmvrlseaevqnpklgeyqcladlnlfdspectrlatqsasgrhlwvts
    nhqnlavevylceddypgwlslsdfdslqpatvpyqaatfseseikkllaeviaftqkam
    qqsnyylwggtvgpnydcsglmqaafasvgiwlprdayqqegftqpitiaelvagdlvff
    gtsqkathvglyladgyyihssgkdqgrdgigidilseqgdavslsyyqqlrgagrvfks
    yepqrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fg0B (B:)
    klgeyqcladlnlfdspectrlatqsasgrhlwvtsnhqnlavevylceddypgwlslsd
    fdslqpatvpyqaatfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqa
    afasvgiwlprdayqqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgk
    dqgrdgigidilseqgdavslsyyqqlrgagrvfksyepqrr