PDB entry 2ffx

View 2ffx on RCSB PDB site
Description: Structure of Human Ferritin L. Chain
Class: Metal Binding Protein
Keywords: Human Ferritin Light Chain Perdeuterated Capsid, Metal Binding Protein
Deposited on 2005-12-20, released 2006-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'J':
    Compound: ferritin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ffxj_
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ffxJ (J:)
    ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
    gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
    tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkh