PDB entry 2ffs

View 2ffs on RCSB PDB site
Description: Structure of PR10-allergen-like protein PA1206 from Pseudomonas aeruginosa PAO1
Class: structural genomics, unknown function
Keywords: 7-STRANDED BETA SHEET, C-TERMINAL HELIX, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2005-12-20, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA1206
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1206
    Database cross-references and differences (RAF-indexed):
    • GB AAG04595 (0-End)
      • modified residue (0)
      • modified residue (95)
      • modified residue (136)
    Domains in SCOPe 2.08: d2ffsa1
  • Chain 'B':
    Compound: hypothetical protein PA1206
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1206
    Database cross-references and differences (RAF-indexed):
    • GB AAG04595 (0-End)
      • modified residue (0)
      • modified residue (95)
      • modified residue (136)
    Domains in SCOPe 2.08: d2ffsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ffsA (A:)
    mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
    ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
    gdelpydafvkqayiamdvetiatirdrfgasaasgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffsA (A:)
    mqfehlvqvndrtlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlylp
    glvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdelp
    ydafvkqayiamdvetiatirdrfga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ffsB (B:)
    mqfehlvqvndrtlvdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrl
    ylpglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpl
    gdelpydafvkqayiamdvetiatirdrfgasaasgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffsB (B:)
    mqfehlvqvndrtdlpvldrlqlweglvcrarepqyfvvglerfeilvddgdrlhrrlyl
    pglvvedevvlkapdsahysikpsaevaggsldmtieepepgslfvrfayctrylqpdel
    pydafvkqayiamdvetiatirdrf