PDB entry 2ffn

View 2ffn on RCSB PDB site
Description: The E41Q mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F
Class: electron transport
Keywords: cytochrome c3, ELECTRON TRANSPORT
Deposited on 2005-12-20, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ffna_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ffnA (A:)
    apkapadglkmdktkqpvvfnhsthkavkcgdchhpvngkedyqkcatagchdnmdkkdk
    sakgyyhamhdkgtkfkscvgchletagadaakkkeltgckgskchs